PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G330800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 985aa    MW: 107652 Da    PI: 4.9971
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G330800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.4e-195096148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd++l +av+ + g++Wk+Ia++++  Rt+ qc +rwqk+l
  Brast01G330800.1.p 50 KGNWTPEEDDILSRAVQTYNGKNWKKIAECFP-DRTDVQCLHRWQKVL 96
                        79******************************.************986 PP

2Myb_DNA-binding61.81.4e-19102148148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g+W++eEde++vd v+++G++ W+tIa+ ++ gR +kqc++rw+++l
  Brast01G330800.1.p 102 KGPWSKEEDEIIVDMVRRYGPKKWSTIAQALP-GRIGKQCRERWHNHL 148
                         79******************************.*************97 PP

3Myb_DNA-binding49.78.3e-16154196145
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         + +WT+eE+ +l++a++++G++ W+   + ++ gRt++++k++w+
  Brast01G330800.1.p 154 KEAWTQEEEIILIHAHRMYGNK-WAELTKFLP-GRTDNSIKNHWN 196
                         579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.4374596IPR017930Myb domain
SuperFamilySSF466891.79E-1646103IPR009057Homeodomain-like
SMARTSM007173.0E-174998IPR001005SANT/Myb domain
PfamPF002498.9E-175096IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-2552108IPR009057Homeodomain-like
CDDcd001678.91E-155296No hitNo description
PROSITE profilePS5129431.61797152IPR017930Myb domain
SuperFamilySSF466896.11E-3199195IPR009057Homeodomain-like
SMARTSM007175.5E-18101150IPR001005SANT/Myb domain
PfamPF002493.2E-17102148IPR001005SANT/Myb domain
CDDcd001671.34E-15104148No hitNo description
Gene3DG3DSA:1.10.10.601.4E-26109151IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-21152203IPR009057Homeodomain-like
PROSITE profilePS5129420.643153203IPR017930Myb domain
SMARTSM007177.2E-15153201IPR001005SANT/Myb domain
PfamPF002494.5E-14154197IPR001005SANT/Myb domain
CDDcd001671.45E-11156196No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 985 aa     Download sequence    Send to blast
MTSDKGKASK KAGEASGLPS SSHEGKVSNE PQRQRSLNGR TTGPTRRSTK GNWTPEEDDI  60
LSRAVQTYNG KNWKKIAECF PDRTDVQCLH RWQKVLNPEL IKGPWSKEED EIIVDMVRRY  120
GPKKWSTIAQ ALPGRIGKQC RERWHNHLNP GINKEAWTQE EEIILIHAHR MYGNKWAELT  180
KFLPGRTDNS IKNHWNSSVK KKIDSYTSSG LLAQVSCLPL IEYPVHCNSS PAMTRQNSGE  240
SGSNAVRELD DSSACIQSSL AMVSSSQNAN VALVCDLQVN EDPSKIEAQD SQSSMCQEAC  300
YPSTEGVASA LSDVHYHVSS SNFDPDKNLQ QEFAQSMNSQ MDIDETPSTS LFADNQTICS  360
TVSNERSLVP YDTAPDMPIS MLPSVSGAEQ NLHFMSEADF GSPNCLKSEL WQDISLQSLL  420
SGPDLVDADS FSTVNHLSDA YSSKGDSNVL APPNPLHTSS MMETAYVQGS LMSVPQSLVC  480
SGLPDAPDDR SEPRDMPVSQ SEAVIHRHDS FGDLEHPANP SSSDGRHGAS AIIEGLPEYG  540
DQQLPDAEEP ATSIANEPSL PQSEAAPDEK QVKGALFYEP PRFPSMDVPF VSCDLVTSGD  600
LQEYSPLGIR QLMRSTMNVS TPLRLWGSPS QDESPGVLLK SAAKSFICTP SILKKRPRDF  660
LSPTPDKRSM KKCGTEKDCG VLGAPSISAE TCCLNATQDE AIVTESVFCT EQPSASFRPL  720
EKKLEFSDEN EENLGETSER KKDGRNAGTN HPTDEQARVE QCSTTNMVNN NDDPPRNLQP  780
AGFLEDKGND LPDHGSNAMD RKINTNPEAS SACKERACAK SKSTELIAEK SSPCINTDYG  840
YVNILADTPG VKRGLESPSA WKSPWFTNMQ YKGSYFVSPA DITYDALGLM KRINVQSAAA  900
LADAREVLSS GKQRDNSKEN KENIDAEKET GTCKSQTKIM AEARVLDFNE CATPVRTASN  960
SVGSSLARSL SSPIPSSHPV KHFR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-68502036159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-68502036159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230653.10.0PREDICTED: myb-related protein 3R-1-like isoform X1
TrEMBLA0A0Q3FVJ90.0A0A0Q3FVJ9_BRADI; Uncharacterized protein
STRINGBRADI2G07677.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.21e-105myb domain protein 3r-4